PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C024440P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family MYB_related
Protein Properties Length: 345aa    MW: 37992.7 Da    PI: 7.2143
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C024440P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding422.2e-13105149347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ + ++lG+g+W+ I+r +  +Rt+ q+ s+ qky
   MELO3C024440P1 105 PWTEEEHRLFLVGLQKLGKGDWRGISRNFVITRTPTQVASHAQKY 149
                      8*****************************99************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.81398154IPR017930Myb domain
SuperFamilySSF466892.69E-17100155IPR009057Homeodomain-like
TIGRFAMsTIGR015573.3E-18101153IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.2E-11102148IPR009057Homeodomain-like
SMARTSM007173.4E-11102152IPR001005SANT/Myb domain
PfamPF002497.0E-12105149IPR001005SANT/Myb domain
CDDcd001671.49E-9105150No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009739Biological Processresponse to gibberellin
GO:0009753Biological Processresponse to jasmonic acid
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MTRRCSHCSN NGHNSRTCPS RGGGGGGSGV KLFGVRLTDG SFIKKSASMG NLSVHYHSSS  60
SAAASPNPDS PNSDPVHDSD GFLSDDPAHA SCSANRRAER KKGVPWTEEE HRLFLVGLQK  120
LGKGDWRGIS RNFVITRTPT QVASHAQKYF IRQSNATRRK RRSSLFDMVP EMATDPLPVP  180
EDEILHASQT KETENSSSQP SLNLSLNSEF HMMETTVEEN GKELDAPKME VAGFPPVIPG  240
FIPAYMPLPF PIWAPSSFPM EEENVVETCH HKVLKPIPVV PKEPVNVDEL VGMSQLTLRE  300
HERERREPSP LSLKLIGERS RQSAFHPNAP VSRSELIKDD TDTI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818050.0LN681805.1 Cucumis melo genomic scaffold, anchoredscaffold00067.
GenBankLN7132550.0LN713255.1 Cucumis melo genomic chromosome, chr_1.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008462421.10.0PREDICTED: uncharacterized protein LOC103500780
RefseqXP_008462422.10.0PREDICTED: uncharacterized protein LOC103500780
RefseqXP_008462424.10.0PREDICTED: uncharacterized protein LOC103500780
RefseqXP_008462425.10.0PREDICTED: uncharacterized protein LOC103500780
TrEMBLA0A0A0K9S00.0A0A0A0K9S0_CUCSA; Uncharacterized protein
STRINGGLYMA13G43120.11e-151(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF77193346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16350.16e-91MYB_related family protein